HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UH53

Names and origin
Entry : A5UH53 (reviewed)
Entry name : IF1_HAEIG
Protein names : Translation initiation factor IF-1
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
Gene names : infA
ORF names : CGSHiGG_06000
History
Date of creation : 2008-06-10
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; translation initiation factor activity
GO identifier : GO:0005737; GO:0003743
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Initiation factor; Protein biosynthesis
General annotation
Domains : S1-like domain (1)
Sequence similarities : Belongs to IF-1 family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 17550610
Protein sequence
Length : 80 residues
>A5UH53|IF1_HAEIG Haemophilus influenzae PittGG
MAKEDCIEMQGTILETLPNTMFRVELENGHVVTAHISGKMRKNYIRILTGDKVTVEMTPY
DLSKGRIIFRSR