HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UH47

Names and origin
Entry : A5UH47 (reviewed)
Entry name : CH10_HAEIG
Protein names : 10 kDa chaperonin (GroES protein) (Protein Cpn10)
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
Gene names : groS
ORF names : groES
History
Date of creation : 2008-01-15
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ATP binding; cytoplasm; protein folding
GO identifier : GO:0005524; GO:0005737; GO:0006457
Keywords
Ligand & Biological process : Chaperone; Complete proteome; Cytoplasm
General annotation
Sequence similarities : Belongs to GroES chaperonin family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 17550610
Protein sequence
Length : 104 residues
>A5UH47|CH10_HAEIG Haemophilus influenzae PittGG
MNIRPLHDRVIIKREEVETRSAGGIVLTGSAATKSTRAKVLAVGKGRILENGTVQPLDVK
VGDTVIFNDGYGVKNEKIDGEEVLIISENDILAIVE