HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UGZ3

Names and origin
Entry : A5UGZ3 (reviewed)
Entry name : ATPF_HAEIG
Protein names : ATP synthase subunit b (ATP synthase F(0) sector subunit b) (ATPase subunit I) (F-type ATPase subunit b) (F-ATPase subunit b)
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
Gene names : atpF
ORF names : CGSHiGG_05670
History
Date of creation : 2009-04-14
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; plasma membrane; plasma membrane ATP synthesis coupled proton transport; proton-transporting ATP synthase activity, rotational mechanism; proton-transporting ATP synthase complex, coupling factor F(o)
GO identifier : GO:0016021; GO:0005886; GO:0042777; GO:0046933; GO:0045263
Keywords
Ligand & Biological process : ATP synthesis; CF(0); Cell inner membrane; Cell membrane; Complete proteome; Hydrogen ion transport; Ion transport; Membrane; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to ATPase B chain family
Subcellular location : Cell inner membrane; Single-pass membrane protein.
Reference
PubMed ID : 17550610
Protein sequence
Length : 168 residues
>A5UGZ3|ATPF_HAEIG Haemophilus influenzae PittGG
MNLNATLIGQLIAFALFVWFCMKFVWPPIINAIETRQSQIANALASAEAAKKEQADTKNL
VEQELSAAKVQAQEILDAANKRRNEVLDEVKAEAEELKAKIIAQGYAEVEAERKRVQEEL
RLKVASLAVAGAEKIVGRSIDEAANNDIIDKLVAEL