HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UGZ2

Names and origin
Entry : A5UGZ2 (reviewed)
Entry name : ATPD_HAEIG
Protein names : ATP synthase subunit delta (ATP synthase F(1) sector subunit delta) (F-type ATPase subunit delta) (F-ATPase subunit delta)
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
Gene names : atpH
ORF names : CGSHiGG_05665
History
Date of creation : 2009-07-28
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : plasma membrane; plasma membrane ATP synthesis coupled proton transport; proton-transporting ATP synthase activity, rotational mechanism; proton-transporting ATP synthase complex, catalytic core F(1)
GO identifier : GO:0005886; GO:0042777; GO:0046933; GO:0045261
Keywords
Ligand & Biological process : ATP synthesis; CF(1); Cell inner membrane; Cell membrane; Complete proteome; Hydrogen ion transport; Ion transport; Membrane; Transport
General annotation
Sequence similarities : Belongs to ATPase delta chain family
Subcellular location : Cell inner membrane; Peripheral membrane protein.
Reference
PubMed ID : 17550610
Protein sequence
Length : 189 residues
>A5UGZ2|ATPD_HAEIG Haemophilus influenzae PittGG
MSELTTIARPYAKAAFDFAIEQSAVEKWTEMLGFAAAVAEDETVKAYLSSSLSAQKLADT
VISICGEQLDQYGQNLIRLMAENKRLSAIPAVFEEFKHHVEEHQAIAEVEVTSAQPLNAT
QIEKIAAAMEKRLARKVKLNCNVDNALIAGVIVRTEDFVIDGSSRGQLTRLANELQL