HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UGV2

Names and origin
Entry : A5UGV2 (reviewed)
Entry name : Y5435_HAEIG
Protein names : Nucleoid-associated protein CGSHiGG_05435
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
ORF names : CGSHiGG_05435
History
Date of creation : 2008-01-15
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; bacterial nucleoid; cytoplasm
GO identifier : GO:0003677; GO:0043590; GO:0005737
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; DNA-binding
General annotation
Sequence similarities : Belongs to YbaB/EbfC family
Subcellular location : Cytoplasm › nucleoid.
Reference
PubMed ID : 17550610
Protein sequence
Length : 117 residues
>A5UGV2|Y5435_HAEIG Haemophilus influenzae PittGG
MFGKGGLGGLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKIAINGAHNCRRIDIDPS
LMEDDKEMLEDLIAAAFNDAVRRAEELQKEKMASVTAGMPLPPGMKFPF