HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UGU1

Names and origin
Entry : A5UGU1 (unreviewed)
Entry name : A5UGU1_HAEIG
Protein names : DNA-binding protein HU
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
ORF names : CGSHiGG_05370
History
Date of creation : 2007-07-10
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; chromosome condensation
GO identifier : GO:0003677; GO:0030261
Keywords
Ligand & Biological process : Complete proteome; DNA condensation; DNA-binding
General annotation
Sequence similarities : Belongs to Bacterial histone-like protein family
Reference
PubMed ID : 17550610
Protein sequence
Length : 98 residues
>A5UGU1|A5UGU1_HAEIG Haemophilus influenzae PittGG
MNKTDLIDAIANAAELNKKQAKAALEATLDAITASLKEGEPVQLIGFGTFKVNERAARTG
RNPQTGAEIQIAASKVPAFVSGKALKDAIK