HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UGU0

Names and origin
Entry : A5UGU0 (unreviewed)
Entry name : A5UGU0_HAEIG
Protein names : Disulfide bond formation protein B (Disulfide oxidoreductase)
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
Gene names : dsbB
ORF names : CGSHiGG_05355
History
Date of creation : 2007-07-10
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : electron carrier activity; integral to membrane; plasma membrane; protein disulfide oxidoreductase activity
GO identifier : GO:0009055; GO:0016021; GO:0005886; GO:0015035
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Chaperone; Complete proteome; Disulfide bond; Electron transport; Membrane; Oxidoreductase; Redox-active center; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to DsbB family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Reference
PubMed ID : 17550610
Protein sequence
Length : 189 residues
>A5UGU0|A5UGU0_HAEIG Haemophilus influenzae PittGG
MLALLKQFSEKRFVWFLLAFSSLSLESTALYFQYGMGLQPCVLCVYERLAMIGLFVAGII
ALLQPRALIIRLIALALGLFSSIKGLLISFRHLDLQMNPAPWKQCEFIPNFPETLPFHQW
FPFIFNPTGSCNESQWSLFGLTMVQWLVVIFSLYVVILTLLLIAQVIKTRKQRRLFN