HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UGS5

Names and origin
Entry : A5UGS5 (reviewed)
Entry name : HFQ_HAEIG
Protein names : RNA-binding protein Hfq
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
Gene names : hfq
ORF names : CGSHiGG_05240
History
Date of creation : 2008-01-15
Date of modification : 2013-12-11
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : RNA binding; regulation of transcription, DNA-dependent; response to stress
GO identifier : GO:0003723; GO:0006355; GO:0006950
Keywords
Ligand & Biological process : Complete proteome; RNA-binding; Stress response
General annotation
Sequence similarities : Belongs to Hfq family
Reference
PubMed ID : 17550610
Protein sequence
Length : 99 residues
>A5UGS5|HFQ_HAEIG Haemophilus influenzae PittGG
MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAIS
TVVPARSVSHHNNNHHTTPTEAVENVETQAE