HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UGE8

Names and origin
Entry : A5UGE8 (unreviewed)
Entry name : A5UGE8_HAEIG
Protein names : Nitrogen regulatory protein P-II
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
ORF names : CGSHiGG_04485
History
Date of creation : 2007-07-10
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : enzyme regulator activity; regulation of catalytic activity; regulation of nitrogen utilization; regulation of transcription, DNA-dependent; transcription, DNA-dependent
GO identifier : GO:0030234; GO:0050790; GO:0006808; GO:0006355; GO:0006351
Keywords
Ligand & Biological process : Complete proteome; Transcription; Transcription regulation
General annotation
Sequence similarities : Belongs to P(II) protein family
Reference
PubMed ID : 17550610
Protein sequence
Length : 120 residues
>A5UGE8|A5UGE8_HAEIG Haemophilus influenzae PittGG
MKKIEAMIKPFKLDDVRESLSDIGISGMTITEVRGFGRQKGHTELYRGAEYMVDFLPKVK
LEVVVPDELVDQCIEAIIETAQTGKIGDGKIFVYHVERAIRIRTGEENEDAI