HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UGB2

Names and origin
Entry : A5UGB2 (unreviewed)
Entry name : A5UGB2_HAEIG
Protein names : Transcriptional repressor protein MetJ
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
ORF names : CGSHiGG_04285
History
Date of creation : 2007-07-10
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; cytoplasm; methionine biosynthetic process; sequence-specific DNA binding transcription factor activity; transcription, DNA-dependent
GO identifier : GO:0003677; GO:0005737; GO:0009086; GO:0003700; GO:0006351
Keywords
Ligand & Biological process : Amino-acid biosynthesis; Complete proteome; Cytoplasm; DNA-binding; Methionine biosynthesis; Repressor; Transcription; Transcription regulation
General annotation
Subcellular location : Cytoplasm.
Reference
PubMed ID : 17550610
Protein sequence
Length : 77 residues
>A5UGB2|A5UGB2_HAEIG Haemophilus influenzae PittGG
MTNERTRRQLKSLRHATNSELLCEAFLHAFTGQPLPTDADLMKERNDEIPEDAKVLMREL
GVDPESWEY