HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UFY3

Names and origin
Entry : A5UFY3 (unreviewed)
Entry name : A5UFY3_HAEIG
Protein names : Formate acetyltransferase
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
ORF names : CGSHiGG_03500
History
Date of creation : 2007-07-10
Date of modification : 2013-05-01
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : transferase activity
GO identifier : GO:0016740
Keywords
Ligand & Biological process : Complete proteome; Transferase
Reference
PubMed ID : 17550610
Protein sequence
Length : 40 residues
>A5UFY3|A5UFY3_HAEIG Haemophilus influenzae PittGG
MSELNEMQKLAWAGFAGGDWQENVNVRDFIQKTIPL