HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UFX1

Names and origin
Entry : A5UFX1 (reviewed)
Entry name : NQRD_HAEIG
Protein names : Na(+)-translocating NADH-quinone reductase subunit D (Na(+)-NQR subunit D) (Na(+)-translocating NQR subunit D) (EC 1.6.5.-) (NQR complex subunit D) (NQR-1 subunit D)
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
Gene names : nqrD
ORF names : CGSHiGG_03440
EC number : 1.6.5.-
History
Date of creation : 2008-02-05
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor; plasma membrane; sodium ion transport
GO identifier : GO:0016021; GO:0016655; GO:0005886; GO:0006814
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Ion transport; Membrane; NAD; Oxidoreductase; Sodium; Sodium transport; Transmembrane; Transmembrane helix; Transport; Ubiquinone
General annotation
Sequence similarities : Belongs to NqrDE/RnfAE family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Reference
PubMed ID : 17550610
Protein sequence
Length : 224 residues
>A5UFX1|NQRD_HAEIG Haemophilus influenzae PittGG
MSGKTSYKDLLLAPIAKNNPIALQILGICSALAVTTKLETAFVMAIAVTLVTGLSNLFVS
LIRNYIPNSIRIIVQLAIIASLVIVVDQILKAYAYGLSKQLSVFVGLIITNCIVMGRAEA
FAMKSPPVESFVDGIGNGLGYGSMLIIVAFFRELIGSGKLFGMTIFETIQNGGWYQANGL
FLLAPSAFFIIGFVIWGLRTWKPEQQEK