HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UFV8

Names and origin
Entry : A5UFV8 (reviewed)
Entry name : ACP_HAEIG
Protein names : Acyl carrier protein (ACP)
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
Gene names : acpP
ORF names : CGSHiGG_03365
History
Date of creation : 2008-02-05
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ACP phosphopantetheine attachment site binding involved in fatty acid biosynthetic process; cytoplasm
GO identifier : GO:0000036; GO:0005737
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Fatty acid biosynthesis; Fatty acid metabolism; Lipid biosynthesis; Lipid metabolism; Phosphopantetheine
General annotation
Domains : Acyl carrier domain (1)
Pathway : Lipid metabolism; fatty acid biosynthesis.
Subcellular location : Cytoplasm.
Reference
PubMed ID : 17550610
Protein sequence
Length : 84 residues
>A5UFV8|ACP_HAEIG Haemophilus influenzae PittGG
MSIEERVKKIIVEQLGVKEEDVKPEASFVEDLGADSLDTVELVMALEEEFDIEIPDEEAE
KITTVQSAIDYVQNNQ