HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UFP8

Names and origin
Entry : A5UFP8 (unreviewed)
Entry name : A5UFP8_HAEIG
Protein names : Thioredoxin
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
ORF names : CGSHiGG_02965
History
Date of creation : 2007-07-10
Date of modification : 2013-12-11
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cell redox homeostasis; glycerol ether metabolic process; protein disulfide oxidoreductase activity
GO identifier : GO:0045454; GO:0006662; GO:0015035
Keywords
Ligand & Biological process : Complete proteome
General annotation
Domains : Thioredoxin domain (1)
Sequence similarities : Belongs to Thioredoxin family
Reference
PubMed ID : 17550610
Protein sequence
Length : 115 residues
>A5UFP8|A5UFP8_HAEIG Haemophilus influenzae PittGG
MSQVLHINDADFESVVVNSDIPVLLDFWAPWCGPCKMIAPVLDELAPEFAGKVKIVKMNV
DDNQATPAQFGVRSIPTLLLIKNGQVVATQVGALAKTQLANFINQHI