HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UFJ6

Names and origin
Entry : A5UFJ6 (reviewed)
Entry name : CITD_HAEIG
Protein names : Citrate lyase acyl carrier protein (Citrate lyase gamma chain)
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
Gene names : citD
ORF names : CGSHiGG_02605
History
Date of creation : 2008-01-15
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm
GO identifier : GO:0005737
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Phosphoprotein
General annotation
Sequence similarities : Belongs to CitD family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 17550610
Protein sequence
Length : 103 residues
>A5UFJ6|CITD_HAEIG Haemophilus influenzae PittGG
MKITKVAVAGTLESSDVQVRVQPFDSLDIEINSSVAKQFGEQIEATVREVLAKLGITAAQ
VIVEDKGALDCVLQARVKAAAMRATDEMINWEAVL