HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UF44

Names and origin
Entry : A5UF44 (unreviewed)
Entry name : A5UF44_HAEIG
Protein names : Putative uncharacterized protein
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
ORF names : CGSHiGG_01645
History
Date of creation : 2007-07-10
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : integral to membrane; plasma membrane; transporter activity
GO identifier : GO:0016021; GO:0005886; GO:0005215
Keywords
Ligand & Biological process : Cell membrane; Complete proteome; Membrane; Transmembrane; Transmembrane helix; Transport
Reference
PubMed ID : 17550610
Protein sequence
Length : 48 residues
>A5UF44|A5UF44_HAEIG Haemophilus influenzae PittGG
MVRLFLLLTDTLARTIAPIELPLGILTSACGAPFFLYLLVRGQK