HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UEY3

Names and origin
Entry : A5UEY3 (unreviewed)
Entry name : A5UEY3_HAEIG
Protein names : Transcription elongation factor GreA (Transcript cleavage factor GreA)
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
Gene names : greA
ORF names : CGSHiGG_01235
History
Date of creation : 2007-07-10
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; regulation of DNA-dependent transcription, elongation; transcription, DNA-dependent; translation elongation factor activity
GO identifier : GO:0003677; GO:0032784; GO:0006351; GO:0003746
Keywords
Ligand & Biological process : Complete proteome; DNA-binding; Elongation factor; Protein biosynthesis; Transcription; Transcription regulation
General annotation
Sequence similarities : Belongs to GreA/GreB family
Reference
PubMed ID : 17550610
Protein sequence
Length : 170 residues
>A5UEY3|A5UEY3_HAEIG Haemophilus influenzae PittGG
MQQIPMTVRGAEQLREELDFLKNVRRPEIIKAIAEAREHGDLKENAEYHAAREQQGFCEG
RIQEIEGKLGNAQIIDVTKMPNNGKVIFGATVVLVNTNTDEEVTYRIVGDDEADIKSGLI
SVNSPIARGLIGKELDDTVNITTPGGVVEFDIIEVNYI