HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UEV0

Names and origin
Entry : A5UEV0 (reviewed)
Entry name : Y1050_HAEIG
Protein names : UPF0181 protein CGSHiGG_01050
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
ORF names : CGSHiGG_01050
History
Date of creation : 2008-01-15
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Keywords
Ligand & Biological process : Complete proteome
General annotation
Sequence similarities : Belongs to UPF0181 family
Reference
PubMed ID : 17550610
Protein sequence
Length : 56 residues
>A5UEV0|Y1050_HAEIG Haemophilus influenzae PittGG
MFDINLTHEQQQKAVEQIQELMAKGISSGEAIQIVAKALREIHKNDKKTPEN