HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UEK4

Names and origin
Entry : A5UEK4 (unreviewed)
Entry name : A5UEK4_HAEIG
Protein names : Probable molybdenum-pterin binding protein
Organism : Haemophilus influenzae PittGG
Organism ID : 374931
ORF names : CGSHiGG_00520
History
Date of creation : 2007-07-10
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : ATP binding; ATP-binding cassette (ABC) transporter complex; hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances; molybdenum ion binding
GO identifier : GO:0005524; GO:0043190; GO:0016820; GO:0030151
Keywords
Ligand & Biological process : Complete proteome
Reference
PubMed ID : 17550610
Protein sequence
Length : 77 residues
>A5UEK4|A5UEK4_HAEIG Haemophilus influenzae PittGG
MKISARNQLKGKVVSIENGSVNAIVHIDIGGGNVLSSTVSLAAVKELNLEVGKEAYAIIK
ATSVMVGVE