HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UEB0

Names and origin
Entry : A5UEB0 (reviewed)
Entry name : MSCL_HAEIE
Protein names : Large-conductance mechanosensitive channel
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
Gene names : mscL
ORF names : CGSHiEE_09100
History
Date of creation : 2008-01-15
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; ion channel activity; plasma membrane
GO identifier : GO:0016021; GO:0005216; GO:0005886
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Ion channel; Ion transport; Membrane; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to MscL family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Reference
PubMed ID : 17550610
Protein sequence
Length : 140 residues
>A5UEB0|MSCL_HAEIE Haemophilus influenzae PittEE
MNFIKEFREFAMRGNVVDMAVGVIIGSAFGKIVSSLVSDIFMPVLGILTGGIDFKDMKFV
LAQAQGDVPAVTLNYGLFIQNVIDFIIIAFAIFMMIKVINKVRKPEEKKPVPKAETLLTE
IRDLLKNK