HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UE63

Names and origin
Entry : A5UE63 (reviewed)
Entry name : ZAPB_HAEIE
Protein names : Cell division protein ZapB
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
Gene names : zapB
ORF names : CGSHiEE_08835
History
Date of creation : 2008-05-20
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : barrier septum assembly; cytokinesis by binary fission; cytoplasm
GO identifier : GO:0000917; GO:0043093; GO:0005737
Keywords
Ligand & Biological process : Cell cycle; Cell division; Coiled coil; Complete proteome; Cytoplasm; Septation
General annotation
Sequence similarities : Belongs to ZapB family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 17550610
Protein sequence
Length : 80 residues
>A5UE63|ZAPB_HAEIE Haemophilus influenzae PittEE
MSLEILDQLEEKIKQAVETIQLLQLEVEELKEKNAESQRNIENLQTENEQLKNEHRNWQE
HIRSLLGKFDNV