HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UE58

Names and origin
Entry : A5UE58 (reviewed)
Entry name : FTSB_HAEIE
Protein names : Cell division protein FtsB
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
Gene names : ftsB
ORF names : CGSHiEE_08810
History
Date of creation : 2008-01-15
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cell division site; cytokinesis by binary fission; integral to plasma membrane
GO identifier : GO:0032153; GO:0043093; GO:0005887
Keywords
Ligand & Biological process : Cell cycle; Cell division; Cell inner membrane; Cell membrane; Coiled coil; Complete proteome; Membrane; Transmembrane; Transmembrane helix
General annotation
Sequence similarities : Belongs to FtsB family
Subcellular location : Cell inner membrane; Single-pass type II membrane protein.
Reference
PubMed ID : 17550610
Protein sequence
Length : 100 residues
>A5UE58|FTSB_HAEIE Haemophilus influenzae PittEE
MRLLILILLSVLVLFQHDFWFGSNGFLDYRQNAEKIKENQAENEKLSQRNQRINAEIQGL
TKGFEAIEERARMQHGLVKENEVFYHIVKESK