HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UE09

Names and origin
Entry : A5UE09 (unreviewed)
Entry name : A5UE09_HAEIE
Protein names : Protein translocase subunit SecE
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
Gene names : nusG
ORF names : secE
History
Date of creation : 2007-07-10
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : P-P-bond-hydrolysis-driven protein transmembrane transporter activity; integral to membrane; intracellular protein transmembrane transport; plasma membrane; protein secretion; protein targeting; protein transport by the Sec complex
GO identifier : GO:0015450; GO:0016021; GO:0065002; GO:0005886; GO:0009306; GO:0006605; GO:0043952
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Membrane; Protein transport; Translocation; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to SecE/SEC61-gamma family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Reference
PubMed ID : 17550610
Protein sequence
Length : 150 residues
>A5UE09|A5UE09_HAEIE Haemophilus influenzae PittEE
MATEIVDKKKNTQEVIVEGKSKGLNTFLWVLVVIFFAAAAIGNIYFQQIYSLPIRVIGMA
IALVIAFILAAITNQGTKARAFFNDSRTEARKVVWPTRAEARQTTLIVIGVTMIASLFFW
AVDSIIVTVINFLTDLRF