HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UDT8

Names and origin
Entry : A5UDT8 (reviewed)
Entry name : RS17_HAEIE
Protein names : 30S ribosomal protein S17
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
Gene names : rpsQ
ORF names : CGSHiEE_08130
History
Date of creation : 2008-01-15
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier : GO:0019843; GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein S17P family
Reference
PubMed ID : 17550610
Protein sequence
Length : 93 residues
>A5UDT8|RS17_HAEIE Haemophilus influenzae PittEE
MTDKIRSVQGKVVSDKMEKSFVVAIERKVKHPLYGKFIRRTTKLHVHDENNEAKVGDTVE
IRECRPLSKTKSWTLVRVVEKAVIA