HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UDP4

Names and origin
Entry : A5UDP4 (reviewed)
Entry name : TRPR_HAEIE
Protein names : Trp operon repressor homolog
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
Gene names : trpR
ORF names : CGSHiEE_07910
History
Date of creation : 2008-01-15
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; negative regulation of transcription, DNA-dependent; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription, DNA-dependent
GO identifier : GO:0005737; GO:0045892; GO:0043565; GO:0003700; GO:0006351
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; DNA-binding; Repressor; Transcription; Transcription regulation
General annotation
Sequence similarities : Belongs to TrpR family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 17550610
Protein sequence
Length : 109 residues
>A5UDP4|TRPR_HAEIE Haemophilus influenzae PittEE
MYISRNLEQWNAFLQMLKIAFEENKAQEFLTLLLTADERDAVGLRLQIVSQLIDKNMPQR
EIQQNLNTSAATITRGSNMIKTMDPDFMQWMKQHLDLIEKN