HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UDP3

Names and origin
Entry : A5UDP3 (reviewed)
Entry name : MTGA_HAEIE
Protein names : Monofunctional biosynthetic peptidoglycan transglycosylase (Monofunctional TGase) (EC 2.4.2.-)
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
Gene names : mtgA
ORF names : CGSHiEE_07905
EC number : 2.4.2.-
History
Date of creation : 2008-01-15
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; peptidoglycan biosynthetic process; peptidoglycan-based cell wall; plasma membrane; regulation of cell shape; transferase activity, transferring pentosyl groups
GO identifier : GO:0016021; GO:0009252; GO:0009274; GO:0005886; GO:0008360; GO:0016763
Keywords
Ligand & Biological process : Cell membrane; Cell shape; Cell wall biogenesis/degradation; Complete proteome; Membrane; Peptidoglycan synthesis; Transferase; Transmembrane; Transmembrane helix
General annotation
Pathway : Cell wall biogenesis; peptidoglycan biosynthesis.
Sequence similarities : Belongs to Glycosyltransferase 51 family
Subcellular location : Cell membrane; Single-pass membrane protein.
Reference
PubMed ID : 17550610
Protein sequence
Length : 256 residues
>A5UDP3|MTGA_HAEIE Haemophilus influenzae PittEE
MKKTKRIFTALSHLFSPKWWKKNWQRVVLLFFFAVFALLLIFRFVPIPFSAYMVQQKIAN
LLQGDFRYQIQYDWVSLENISPNIQLAVISSEDQRFPEHLGFDFEAIQRAIRYNEKSNKG
IRGASTISQQTAKNLMLWHGQNWLRKGLEVPATMLLELTWSKKRILEVYLNIAEFGNGIF
GVEAASRYYFKKSAKNLSQNEAALLVAVLPNPIIYKVNKPSLLVRKKTSLDFETNGKFRY