HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UDN4

Names and origin
Entry : A5UDN4 (unreviewed)
Entry name : A5UDN4_HAEIE
Protein names : Outer membrane protein assembly factor BamE
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
Gene names : bamE
ORF names : CGSHiEE_07860
History
Date of creation : 2007-07-10
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : Gram-negative-bacterium-type cell outer membrane assembly; cell outer membrane; plasma membrane; protein insertion into membrane
GO identifier : GO:0043165; GO:0009279; GO:0005886; GO:0051205
Keywords
Ligand & Biological process : Cell membrane; Cell outer membrane; Complete proteome; Lipoprotein; Membrane; Palmitate; Signal
General annotation
Sequence similarities : Belongs to BamE family
Subcellular location : Cell outer membrane; Lipid-anchor.
Reference
PubMed ID : 17550610
Protein sequence
Length : 149 residues
>A5UDN4|A5UDN4_HAEIE Haemophilus influenzae PittEE
MQVKTLLGATFLALSLASCSTVEKVVYRIDVPQGNYLEATTVAQVKEGMTAQQVQYLLGT
PVLVDPYNSQTWYYVFLQQRAYETPVQHTLTVKFDPHGIVTETHLDKPLPQVSQQGENNT
IIETGEKPKSSWWKFWK