HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UDL7

Names and origin
Entry : A5UDL7 (reviewed)
Entry name : ZAPA_HAEIE
Protein names : Cell division protein ZapA (Z ring-associated protein ZapA)
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
Gene names : zapA
ORF names : CGSHiEE_07755
History
Date of creation : 2008-09-02
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : barrier septum assembly; cytoplasm
GO identifier : GO:0000917; GO:0005737
Keywords
Ligand & Biological process : Cell cycle; Cell division; Coiled coil; Complete proteome; Cytoplasm; Septation
General annotation
Sequence similarities : Belongs to ZapA family, Type 1 subfamily
Subcellular location : Cytoplasm.
Reference
PubMed ID : 17550610
Protein sequence
Length : 108 residues
>A5UDL7|ZAPA_HAEIE Haemophilus influenzae PittEE
MSLKLVEILVLGQVLRLNVPIEQEELLRQAARNLDILVSEMKEKTGLIQLDRVLSIVALN
LSFELSQEKNKTAKIEEVLRTGIQQLDHSLENIRVTKEPH