HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UDI2

Names and origin
Entry : A5UDI2 (reviewed)
Entry name : YACG_HAEIE
Protein names : DNA gyrase inhibitor YacG
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
Gene names : yacG
ORF names : CGSHiEE_07570
History
Date of creation : 2008-01-15
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA topoisomerase (ATP-hydrolyzing) inhibitor activity; negative regulation of DNA topoisomerase (ATP-hydrolyzing) activity; regulation of transcription, DNA-dependent; zinc ion binding
GO identifier : GO:0008657; GO:2000372; GO:0006355; GO:0008270
Keywords
Ligand & Biological process : Complete proteome; Metal-binding; Zinc
General annotation
Sequence similarities : Belongs to DNA gyrase inhibitor YacG family
Reference
PubMed ID : 17550610
Protein sequence
Length : 76 residues
>A5UDI2|YACG_HAEIE Haemophilus influenzae PittEE
MSDEIIEVPCPICQKSVPWTNESTFRPFCSKRCQLIDLGEWAAEEKAIPSDTADFAMDPN
VSDEWSIK