HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UDB7

Names and origin
Entry : A5UDB7 (reviewed)
Entry name : RL28_HAEIE
Protein names : 50S ribosomal protein L28
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
Gene names : rpmB
ORF names : CGSHiEE_07205
History
Date of creation : 2008-01-15
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ribosome; structural constituent of ribosome; translation
GO identifier : GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Ribonucleoprotein; Ribosomal protein
General annotation
Sequence similarities : Belongs to Ribosomal protein L28P family
Reference
PubMed ID : 17550610
Protein sequence
Length : 86 residues
>A5UDB7|RL28_HAEIE Haemophilus influenzae PittEE
MSRVCQVTGKRPAVGNNRSHAMNATRRRFLPNLHTHRFWVESENRFVTLRLTAKGMRIID
KKGIDAVLAEIRARGEKI