HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UD12

Names and origin
Entry : A5UD12 (reviewed)
Entry name : CCME_HAEIE
Protein names : Cytochrome c-type biogenesis protein CcmE (Cytochrome c maturation protein E) (Heme chaperone CcmE)
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
Gene names : ccmE
ORF names : cycJ
History
Date of creation : 2008-02-05
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytochrome complex assembly; integral to membrane; metal ion binding; plasma membrane; protein-heme linkage
GO identifier : GO:0017004; GO:0016021; GO:0046872; GO:0005886; GO:0017003
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Cytochrome c-type biogenesis; Heme; Iron; Membrane; Metal-binding; Signal-anchor; Transmembrane; Transmembrane helix
General annotation
Sequence similarities : Belongs to CcmE/CycJ family
Subcellular location : Cell inner membrane; Single-pass type II membrane protein; Periplasmic side.
Reference
PubMed ID : 17550610
Protein sequence
Length : 185 residues
>A5UD12|CCME_HAEIE Haemophilus influenzae PittEE
MNPRRKSRFKLVIFVVLGIAIASGLMLYALRQNIDLFYTPSEVIQGKDNNPNQKPEVGQR
IRVGGMVVEGTVVRDPKSLKVRFDLNDIGPAITVEYEGILPDLFREGQGIVAQGVLTQSA
VLSATEVLAKHDENYVPPELGEKMQKVHKPMGIKAADLKGESARDRQEKEGAK