HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UCU2

Names and origin
Entry : A5UCU2 (unreviewed)
Entry name : A5UCU2_HAEIE
Protein names : Glutaredoxin
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
ORF names : CGSHiEE_06220
History
Date of creation : 2007-07-10
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cell redox homeostasis; electron carrier activity; protein disulfide oxidoreductase activity
GO identifier : GO:0045454; GO:0009055; GO:0015035
Keywords
Ligand & Biological process : Complete proteome
General annotation
Sequence similarities : Belongs to Glutaredoxin family, Monothiol subfamily
Reference
PubMed ID : 17550610
Protein sequence
Length : 115 residues
>A5UCU2|A5UCU2_HAEIE Haemophilus influenzae PittEE
METLDKIKKQISENPILIYMKGSPKFPSCGFSARASEALMNCKVPFGYVDILQHPDIRAE
LPTYANWPTFPQLWVDGELIGGCDIILEMYQAGELQTLLAEVAAKHV