HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UCQ2

Names and origin
Entry : A5UCQ2 (reviewed)
Entry name : ARGR_HAEIE
Protein names : Arginine repressor
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
Gene names : argR
ORF names : CGSHiEE_05990
History
Date of creation : 2008-01-15
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; arginine binding; arginine biosynthetic process; cytoplasm; protein oligomerization; sequence-specific DNA binding transcription factor activity; transcription, DNA-dependent
GO identifier : GO:0003677; GO:0034618; GO:0006526; GO:0005737; GO:0051259; GO:0003700; GO:0006351
Keywords
Ligand & Biological process : Amino-acid biosynthesis; Arginine biosynthesis; Complete proteome; Cytoplasm; DNA-binding; Repressor; Transcription; Transcription regulation
General annotation
Pathway : Amino-acid biosynthesis; L-arginine biosynthesis [regulation].
Sequence similarities : Belongs to ArgR family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 17550610
Protein sequence
Length : 163 residues
>A5UCQ2|ARGR_HAEIE Haemophilus influenzae PittEE
MTDNLTRAFKELLNQERFGSQSEIVDALKKQGFTGINQSKISRMLSKFGAVRTRNTKMEM
VYCLPNELSVPNTSSPLKNLVLDVDHNAMLIVIKTTPGAAQLIARLLDSIGKSEGILGTI
AGDDTIFVTPTSDKPIDELLQNVQRLFENAL