HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UCP2

Names and origin
Entry : A5UCP2 (unreviewed)
Entry name : A5UCP2_HAEIE
Protein names : Cytidylate kinase
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
ORF names : CGSHiEE_05930
History
Date of creation : 2007-07-10
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : kinase activity
GO identifier : GO:0016301
Keywords
Ligand & Biological process : Complete proteome; Kinase; Transferase
Reference
PubMed ID : 17550610
Protein sequence
Length : 35 residues
>A5UCP2|A5UCP2_HAEIE Haemophilus influenzae PittEE
MGMIITVDGPSGAGKGTLCYALAEKLGYAFY