HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UCJ2

Names and origin
Entry : A5UCJ2 (unreviewed)
Entry name : A5UCJ2_HAEIE
Protein names : Putative ABC-type chelated iron transport system, permease component
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
ORF names : CGSHiEE_05630
History
Date of creation : 2007-07-10
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ATP binding; ATPase activity, coupled to transmembrane movement of substances; integral to membrane
GO identifier : GO:0005524; GO:0042626; GO:0016021
Keywords
Ligand & Biological process : Complete proteome; Membrane; Transmembrane; Transport
General annotation
Sequence similarities : Belongs to ABC-3 integral membrane protein family
Subcellular location : Membrane; Multi-pass membrane protein.
Reference
PubMed ID : 17550610
Protein sequence
Length : 120 residues
>A5UCJ2|A5UCJ2_HAEIE Haemophilus influenzae PittEE
MSVDFWEQLSEKFRNSTAIWFVNAACFNHCKYDASGRRYFGGGNVNCVKNYRTYAHKSFD
KMLWIAIISSIISSLIGVILSYHFDASTGACIILLQATFFVIALAYSKIRTR