HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UCA8

Names and origin
Entry : A5UCA8 (reviewed)
Entry name : IHFA_HAEIE
Protein names : Integration host factor subunit alpha (IHF-alpha)
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
Gene names : ihfA
ORF names : himA
History
Date of creation : 2008-02-05
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; DNA recombination; regulation of transcription, DNA-dependent; regulation of translation; transcription, DNA-dependent
GO identifier : GO:0003677; GO:0006310; GO:0006355; GO:0006417; GO:0006351
Keywords
Ligand & Biological process : Complete proteome; DNA recombination; DNA-binding; Transcription; Transcription regulation; Translation regulation
General annotation
Sequence similarities : Belongs to Bacterial histone-like protein family
Reference
PubMed ID : 17550610
Protein sequence
Length : 104 residues
>A5UCA8|IHFA_HAEIE Haemophilus influenzae PittEE
MATITKLDIIEYLSDKYHLSKQDTKNVVENFLEEIRLSLESGQDVKLSGFGNFELRDKSS
RPGRNPKTGDVVAVSARRVVTFKPGQKLRARVEKTK