HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UC93

Names and origin
Entry : A5UC93 (unreviewed)
Entry name : A5UC93_HAEIE
Protein names : 50S ribosomal protein L35
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
ORF names : CGSHiEE_05015
History
Date of creation : 2007-07-10
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ribosome; structural constituent of ribosome; translation
GO identifier : GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Complete proteome; Ribonucleoprotein; Ribosomal protein
General annotation
Sequence similarities : Belongs to Ribosomal protein L35P family
Reference
PubMed ID : 17550610
Protein sequence
Length : 97 residues
>A5UC93|A5UC93_HAEIE Haemophilus influenzae PittEE
MLPSNFLSSPDYVVLNEKCGVILTMPKIKTVRGAAKRFKKTASGGFKRKQSHLRHILTKK
TTKRKRHLRHKSMVAKADQVLVVACLPYA