HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UC14

Names and origin
Entry : A5UC14 (unreviewed)
Entry name : A5UC14_HAEIE
Protein names : Putative uncharacterized protein
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
ORF names : CGSHiEE_04600
History
Date of creation : 2007-07-10
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : hydrolase activity, acting on ester bonds; mRNA binding
GO identifier : GO:0016788; GO:0003729
Keywords
Ligand & Biological process : Complete proteome
Reference
PubMed ID : 17550610
Protein sequence
Length : 64 residues
>A5UC14|A5UC14_HAEIE Haemophilus influenzae PittEE
MHSGDLIKELKANGCYFVRHGKGDHQIWFSPKTGKRFPVPHPKQDLAIGTLKSIKKSAGL