HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UBN4

Names and origin
Entry : A5UBN4 (reviewed)
Entry name : IHFB_HAEIE
Protein names : Integration host factor subunit beta (IHF-beta)
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
Gene names : ihfB
ORF names : himD
History
Date of creation : 2008-02-05
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; DNA recombination; chromosome; regulation of transcription, DNA-dependent; regulation of translation; transcription, DNA-dependent
GO identifier : GO:0003677; GO:0006310; GO:0005694; GO:0006355; GO:0006417; GO:0006351
Keywords
Ligand & Biological process : Complete proteome; DNA recombination; DNA-binding; Transcription; Transcription regulation; Translation regulation
General annotation
Sequence similarities : Belongs to Bacterial histone-like protein family
Reference
PubMed ID : 17550610
Protein sequence
Length : 102 residues
>A5UBN4|IHFB_HAEIE Haemophilus influenzae PittEE
MTKSELMEKLSAKQPTLSAKEIENMVKDILEFISQSLENGDRVEVRGFGSFSLHHRQPRL
GRNPKTGDSVNLSAKSVPYFKAGKELKARVDVQA