HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UBM3

Names and origin
Entry : A5UBM3 (reviewed)
Entry name : Y3775_HAEIE
Protein names : UPF0102 protein CGSHiEE_03775
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
ORF names : CGSHiEE_03775
History
Date of creation : 2008-01-15
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : nuclease activity; nucleic acid binding; nucleic acid phosphodiester bond hydrolysis
GO identifier : GO:0004518; GO:0003676; GO:0090305
Keywords
Ligand & Biological process : Complete proteome
General annotation
Sequence similarities : Belongs to UPF0102 family
Reference
PubMed ID : 17550610
Protein sequence
Length : 127 residues
>A5UBM3|Y3775_HAEIE Haemophilus influenzae PittEE
MFSLKRQQGASFEHQARLFLESKGLTFIAANQNFKCGELDLIMNDKETIVFVEVRQRSHS
AYGSAIESVDWRKQQKWLDAANLWLAKQNMSLEDANCRFDLIAFGKTPQDIQWIPNFLD