HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UBG3

Names and origin
Entry : A5UBG3 (unreviewed)
Entry name : A5UBG3_HAEIE
Protein names : Ribosome-associated GTPase (EC 3.6.1.-)
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
ORF names : CGSHiEE_03465
EC number : 3.6.1.-
History
Date of creation : 2007-07-10
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; hydrolase activity; kinase activity; phosphoenolpyruvate-dependent sugar phosphotransferase system; sugar:hydrogen symporter activity
GO identifier : GO:0005737; GO:0016787; GO:0016301; GO:0009401; GO:0005351
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Hydrolase; Kinase; Phosphotransferase system; Transferase
General annotation
Subcellular location : Cytoplasm.
Reference
PubMed ID : 17550610
Protein sequence
Length : 93 residues
>A5UBG3|A5UBG3_HAEIE Haemophilus influenzae PittEE
MYSKDVEIIAPNGLHTRPAAQFVKEAKAFSSEITVTSGGKSASAKSLFKLQTLVLTQGTI
LTISADGEDEQQAVDHLVALIPTLE