HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UBF7

Names and origin
Entry : A5UBF7 (reviewed)
Entry name : ERPA_HAEIE
Protein names : Iron-sulfur cluster insertion protein ErpA
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
Gene names : erpA
ORF names : CGSHiEE_03435
History
Date of creation : 2007-11-13
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : iron ion binding; iron-sulfur cluster assembly; iron-sulfur cluster binding; structural molecule activity
GO identifier : GO:0005506; GO:0016226; GO:0051536; GO:0005198
Keywords
Ligand & Biological process : Complete proteome; Iron; Iron-sulfur; Metal-binding
General annotation
Sequence similarities : Belongs to HesB/IscA family
Reference
PubMed ID : 17550610
Protein sequence
Length : 122 residues
>A5UBF7|ERPA_HAEIE Haemophilus influenzae PittEE
MIDDIAVPLTFTDAAANKVKSLISEEENTDLKLRVYITGGGCSGFQYGFTFDEKVNDGDL
TIEKSGVQLVIDPMSLQYLIGGTVDYTEGLEGSRFTVNNPNATSTCGCGSSFSI