HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UBD4

Names and origin
Entry : A5UBD4 (reviewed)
Entry name : YBEY_HAEIE
Protein names : Endoribonuclease YbeY (EC 3.1.-.-)
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
Gene names : ybeY
ORF names : CGSHiEE_03300
EC number : 3.1.-.-
History
Date of creation : 2008-01-15
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; endoribonuclease activity; metalloendopeptidase activity; nucleic acid phosphodiester bond hydrolysis; rRNA processing; zinc ion binding
GO identifier : GO:0005737; GO:0004521; GO:0004222; GO:0090305; GO:0006364; GO:0008270
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Endonuclease; Hydrolase; Metal-binding; Nuclease; Ribosome biogenesis; Zinc; rRNA processing
General annotation
Sequence similarities : Belongs to Endoribonuclease YbeY family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 17550610
Protein sequence
Length : 166 residues
>A5UBD4|YBEY_HAEIE Haemophilus influenzae PittEE
MGSVLVDLQIATENIEGLPTEEQIVQWATAAIQPEGNEVEMTVRIVDEAESHELNLTYRG
KDRPTNVLSFPFECPDEVELPLLGDLVICRQVVEREAAEQEKPLMAHWAHMVVHGGLHLL
GYDHIEDDEAEEMESLETQIMQGLGFDDPYLAEK