HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UBA4

Names and origin
Entry : A5UBA4 (unreviewed)
Entry name : A5UBA4_HAEIE
Protein names : Ribosomal silencing factor RsfS
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
Gene names : rsfS
ORF names : CGSHiEE_03140
History
Date of creation : 2007-07-10
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; mature ribosome assembly; negative regulation of ribosome biogenesis; negative regulation of translation
GO identifier : GO:0005737; GO:0042256; GO:0090071; GO:0017148
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Repressor; Translation regulation
General annotation
Sequence similarities : Belongs to Iojap/RsfS family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 17550610
Protein sequence
Length : 110 residues
>A5UBA4|A5UBA4_HAEIE Haemophilus influenzae PittEE
MALVEFLMETLDGLKGTDIVHFDVRGKSSITDNMIICTGTSSRQVSAMADNLITECKKAG
FETFGEEGKNTADWIVVDLGQAIVHIMQRDAREMYQLEKLWA