HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UAM4

Names and origin
Entry : A5UAM4 (reviewed)
Entry name : PLSY_HAEIE
Protein names : Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (GPAT) (EC 2.3.1.n3) (Lysophosphatidic acid synthase) (LPA synthase)
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
Gene names : plsY
ORF names : CGSHiEE_01725
EC number : 2.3.1.n3
History
Date of creation : 2008-02-05
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : acyl-phosphate glycerol-3-phosphate acyltransferase activity; integral to membrane; phospholipid biosynthetic process; plasma membrane
GO identifier : GO:0043772; GO:0016021; GO:0008654; GO:0005886
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Lipid biosynthesis; Lipid metabolism; Membrane; Phospholipid biosynthesis; Phospholipid metabolism; Transferase; Transmembrane; Transmembrane helix
General annotation
Pathway : Lipid metabolism; phospholipid metabolism.
Sequence similarities : Belongs to PlsY family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Reference
PubMed ID : 17550610
Protein sequence
Length : 215 residues
>A5UAM4|PLSY_HAEIE Haemophilus influenzae PittEE
MSLFALFYMLFAYLLGSVSSAILICRIAGLPDPRQNGSHNPGATNVLRIGNRKSALAVLI
FDMLKGMIPVWAGYYLGLTQFELGMVALGACLGHIFPIFFQFKGGKGVATAFGAIAPISW
AVAGSMFGTWIFVFLVSGYSSLSAVISALLVPFYVWWFKPEFTFPVALVCCLLIYRHHDN
IQRLWRGQEDKVWAKFKKK