HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UAE8

Names and origin
Entry : A5UAE8 (unreviewed)
Entry name : A5UAE8_HAEIE
Protein names : Primosome assembly protein PriA
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
ORF names : CGSHiEE_01315
History
Date of creation : 2007-07-10
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : enzyme regulator activity; regulation of catalytic activity; regulation of nitrogen utilization; regulation of transcription, DNA-dependent; transcription, DNA-dependent
GO identifier : GO:0030234; GO:0050790; GO:0006808; GO:0006355; GO:0006351
Keywords
Ligand & Biological process : Complete proteome; Transcription; Transcription regulation
General annotation
Sequence similarities : Belongs to P(II) protein family
Reference
PubMed ID : 17550610
Protein sequence
Length : 120 residues
>A5UAE8|A5UAE8_HAEIE Haemophilus influenzae PittEE
MKKIEAMIKPFKLDDVRESLSDIGISGMTITEVRGFGRQKGHTELYRGAEYMVDFLPKVK
LEVVVPDELVDQCIEAIVETAQTGKIGDGKIFVYHVERAIRIRTGEENEDAI