HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UAD8

Names and origin
Entry : A5UAD8 (unreviewed)
Entry name : A5UAD8_HAEIE
Protein names : Periplasmic nitrate reductase, electron transfer subunit (Diheme cytochrome c NapB)
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
Gene names : adk
ORF names : CGSHiEE_01265
History
Date of creation : 2007-07-10
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : kinase activity; metal ion binding; oxidation-reduction process; periplasmic space
GO identifier : GO:0016301; GO:0046872; GO:0055114; GO:0042597
Keywords
Ligand & Biological process : Complete proteome; Electron transport; Heme; Iron; Kinase; Metal-binding; Periplasm; Transferase; Transport
General annotation
Sequence similarities : Belongs to NapB family
Subcellular location : Periplasm.
Reference
PubMed ID : 17550610
Protein sequence
Length : 159 residues
>A5UAD8|A5UAD8_HAEIE Haemophilus influenzae PittEE
MTKQVSKILAGLFTALFAGSLMASDAPAVGKDLTQAAENIPPAFHNAPRQGELPALNYVN
QPPMVPHSVANYQVTKNVNQCLNCHSPENSRLSGATRISPTHFMDRDGKVGSSSSPRRYF
CLQCHVSQANVDPIVPNDFKPMKGYGN