HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UA17

Names and origin
Entry : A5UA17 (unreviewed)
Entry name : A5UA17_HAEIE
Protein names : Imidazole glycerol phosphate synthase subunit HisH (EC 2.4.2.-) (IGP synthase glutamine amidotransferase subunit) (IGP synthase subunit HisH) (ImGP synthase subunit HisH)
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
Gene names : hisH
ORF names : CGSHiEE_00630
EC number : 2.4.2.-
History
Date of creation : 2007-07-10
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; glutamine metabolic process; histidine biosynthetic process; imidazoleglycerol-phosphate synthase activity; isomerase activity
GO identifier : GO:0005737; GO:0006541; GO:0000105; GO:0000107; GO:0016853
Keywords
Ligand & Biological process : Amino-acid biosynthesis; Complete proteome; Cytoplasm; Glutamine amidotransferase; Histidine biosynthesis; Isomerase; Transferase
General annotation
Domains : Glutamine amidotransferase type-1 domain (1)
Pathway : Amino-acid biosynthesis; L-histidine biosynthesis; L-histidine from 5-phospho-alpha-D-ribose 1-diphosphate: step 5/9.
Subcellular location : Cytoplasm.
Reference
PubMed ID : 17550610
Protein sequence
Length : 215 residues
>A5UA17|A5UA17_HAEIE Haemophilus influenzae PittEE
MTNITIIDTGCANLSSVKFAFDRLGYNTEITFDLNKIKSADKLILPGVGTANAAMYNLQE
RQLIETIQNLTQPVLGICLGMQLMTEFSEEGNVPTLNLISGKTNRIPDTGLPLPQMGWNR
VQFVKNCPLFDGIVQNSHFYFVHSYAVSPNEHSVAISNYGVNFSAAIAKENFYGVQFHPE
RSGKNGALLLKNFVEKVPF