HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5UA12

Names and origin
Entry : A5UA12 (reviewed)
Entry name : ATPE_HAEIE
Protein names : ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit)
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
Gene names : atpC
ORF names : CGSHiEE_00595
History
Date of creation : 2008-01-15
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ATP binding; plasma membrane; plasma membrane ATP synthesis coupled proton transport; proton-transporting ATP synthase activity, rotational mechanism; proton-transporting ATP synthase complex, catalytic core F(1); proton-transporting ATPase activity, rota
GO identifier : GO:0005524; GO:0005886; GO:0042777; GO:0046933; GO:0045261; GO:0046961
Keywords
Ligand & Biological process : ATP synthesis; CF(1); Cell inner membrane; Cell membrane; Complete proteome; Hydrogen ion transport; Ion transport; Membrane; Transport
General annotation
Sequence similarities : Belongs to ATPase epsilon chain family
Subcellular location : Cell inner membrane; Peripheral membrane protein.
Reference
PubMed ID : 17550610
Protein sequence
Length : 154 residues
>A5UA12|ATPE_HAEIE Haemophilus influenzae PittEE
MATFNLTIVSAEQKIFEGEVKQIQVTGVEGELGILPGHTPLLTAIKPGIVKFTLKDGNEE
VIYVSGGFLEVQPNIVTVLADIAIRGSELDADRIHEAKRKAEENIVSRGSDADHDLLVAK
LSKELAKLRAYELTEKLLKTRR