HIGDB - Haemophilus influenzae Genome Database

Protein search results for - A5U9U9

Names and origin
Entry : A5U9U9 (reviewed)
Entry name : PRIB_HAEIE
Protein names : Primosomal replication protein n
Organism : Haemophilus influenzae PittEE
Organism ID : 374930
Gene names : priB
ORF names : CGSHiEE_00260
History
Date of creation : 2008-05-20
Date of modification : 2013-11-13
Date of sequence modification : 2007-07-10
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA replication, synthesis of RNA primer; primosome complex; single-stranded DNA binding
GO identifier : GO:0006269; GO:1990077; GO:0003697
Keywords
Ligand & Biological process : Complete proteome; DNA replication; DNA-binding; Primosome
General annotation
Domains : SSB domain (1)
Sequence similarities : Belongs to PriB family
Reference
PubMed ID : 17550610
Protein sequence
Length : 116 residues
>A5U9U9|PRIB_HAEIE Haemophilus influenzae PittEE
MLKSNLKIDNRFSVMGVVSQLPKRLKSPSGIEHCKFLLEHRSDQIESGFTRQAWLKMPVQ
ISGNQLIEKTQSITVGSKILVVGFITSHKTQSGLCQLVLHAEQIEFID